ZNF598 Antibody

Product Specs
ItemZNF598 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $559.00Supplier Page View Company Product Page
Catalog NumberNBP1-84658
HostRabbit
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: TTTTTKAPRL LPAPRAYLVP ENFRERNLQL IQSIRDFLQS DEARFSEFKS HSGEFRQGLI SAAQYYKSCR DLLGENFQKV F
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Quantity0.1 ml (also 25ul)
TargetZNF598
ReactivityHuman
IsotypeIgG
ClonalityPolyclonal
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namezinc finger protein 598, E3 ubiquitin ligase
NCBI Gene AliasesHEL2
PurityAffinity purified

Sequence

TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Crosstalk between the ribosome quality control‐associated E3 ubiquitin ligases LTN1 and RNF10FEBS LettersDecember 26, 2025Yuxi Huang, Satoshi Hashimoto, Sota Ito, Chisato Kikuguchi, Miho Hoshi, Kiyoshi Yamaguchi, Yoichi Furukawa, Toru Suzuki, Toshifumi InadaResource,Source,Identifier,Dilution Anti‐RNF10,"Proteintech (Rosemont, IL, USA)",16936‐1‐AP,1 : 1000 Anti‐ZNF598,"NOVUS (Centennial, CO, USA)",NBP1‐84658,1 : 1000 Anti‐NEMF,Proteintech,11840‐1‐AP,1 : 1000 Anti‐LTN1,Proteintech,28452‐1‐AP,1 : 1000 Anti‐HA,"Roche

(2) Translation of zinc finger domains induces ribosome collision and Znf598-dependent mRNA decay in zebrafishPLoS biologyDecember 1, 2024Ishibashi K, Shichino Y, Han P, Wakabayashi K, Mito M, Inada T, Kimura S, Iwasaki S, Mishima Y.an Amersham Imager 680 (Cytiva). Human proteins were detected using anti-ZNF598 (Novus Biologicals #NBP1-84658 rabbit polyclonal, 1:1,000), anti-β-actin (Medical and Biological Laboratories #M177-3 mouse monoclonal,

(3) Unresolved stalled ribosome complexes restrict cell-cycle progression after genotoxic stressMolecular cellApril 21, 2022Stoneley M, Harvey RF, Mulroney TE, Mordue R, Jukes-Jones R, Cain K, Lilley KS, Sawarkar R, Willis AE.anti-rpS6,Cell Signaling,Cat. #2217; RRID: AB_331355 Rabbit polyclonal anti-ZNF598,Novus Biologicals,Cat. #NBP1-84658; RRID: AB_11039996 Rabbit polyclonal anti-Pelo,Proteintech,Cat. #10582-1-AP; RRID: AB_2236833 Rabbit

(4) Genome-wide Survey of Ribosome CollisionCell reportsMay 5, 2020Han P, Shichino Y, Schneider-Poetsch T, Mito M, Hashimoto S, Udagawa T, Kohno K, Yoshida M, Mishima Y, Inada T, et al.Laboratories (MBL), M177–3], anti-HA-Peroxidase (Roche, 12013819001), anti-ZNF598 (Novus Biologicals, NBP1–84658), anti-neomycin phosphotransferase II (Millipore, 06–747), anti-GFP (MBL, 598), anti-MTDH (CST, 14065),

(5) Identification of a novel trigger complex that facilitates ribosome-associated quality control in mammalian cellsScientific reportsFebruary 25, 2020Hashimoto S, Sugiyama T, Yamazaki R, Nobuta R, Inada T.antibody,Sigma-Aldrich,F1804-1MG,1:5000 anti-HA-Peroxidase,Roche,12013819001,1:3000 Mouse monoclonal anti-V5-Tag,BIO-RAD,MCA1360,1:3000 Rabbit polyclonal anti-ZNF598,Novus Biologicals,NBP1-84658,1:2000 Rabbit polyclonal anti-ASCC3,Proteintech,17627-1-AP,1:2000 Rabbit polyclonal anti-ASCC2,BETHYL,A304-020A,1:2000 Mouse

Be the First to Write a Review!

ZNF598 Antibody

ZNF598 Antibody

ZNF598 Antibody

ZNF598 Antibody

ZNF598 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (5)

Reviews

ZNF598 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map