MAT2B Antibody - BSA Free NBP1-82797 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

MAT2B Antibody

Western Blot: MAT2B Antibody [NBP1-82797]
MAT2B Antibody

MAT2B Antibody
MAT2B Antibody

Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
MAT2B Antibody

Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
MAT2B Antibody

Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
MAT2B Antibody - BSA Free

Product Specs
ItemMAT2B Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-82797
ReactivityHuman,Rat
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
TargetMAT2B
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MFDKVQFSNK SANMDHWQQR FPTHVKDVAT VCRQLAEKRM LDPSIKGTFH WSGNEQMTKY EMACAIADAF N
HostRabbit
NCBI Gene AliasesTGR, SDR23E1, MAT-II, Nbla02999, MATIIbeta
NCBI Full Gene Namemethionine adenosyltransferase 2 non-catalytic beta subunit
IsotypeIgG
PurityAffinity purified
Molecular Weight38 kDa
Research AreaStem Cell Markers
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
ClonalityPolyclonal
ApplicationsWB, IHC, IHC-p
FormatPBS (pH 7.2) and 40% Glycerol

Sequence

MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) MicroRNA-203 impacts on the growth, aggressiveness and prognosis of hepatocellular carcinoma by targeting MAT2A and MAT2B genesOncotargetApril 19, 2019Simile MM, Peitta G, Tomasi ML, Brozzetti S, Feo CF, Porcu A, Cigliano A, Calvisi DF, Feo F, Pascale RM.

(2) Novel function and intracellular localization of methionine adenosyltransferase 2beta splicing variantsThe Journal of biological chemistryJune 25, 2010Xia M, Chen Y, Wang LC, Zandi E, Yang H, Bemanian S, Martínez-Chantar ML, Mato JM, Lu SC.

(3) Changes in the expression of methionine adenosyltransferase genes and S-adenosylmethionine homeostasis during hepatic stellate cell activationHepatology (Baltimore, Md.)March 1, 2010Ramani K, Yang H, Kuhlenkamp J, Tomasi L, Tsukamoto H, Mato JM, Lu SC.

Be the First to Write a Review!