OSBPL6 Antibody - BSA Free NBP1-82475 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

OSBPL6 Antibody

Immunocytochemistry/Immunofluorescence: OSBPL6 Antibody [NBP1-82475] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.
OSBPL6 Antibody

OSBPL6 Antibody
OSBPL6 Antibody

Immunocytochemistry/Immunofluorescence: OSBPL6 Antibody [NBP1-82475] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.
OSBPL6 Antibody

Immunocytochemistry/Immunofluorescence: OSBPL6 Antibody [NBP1-82475] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.
OSBPL6 Antibody

Immunocytochemistry/Immunofluorescence: OSBPL6 Antibody [NBP1-82475] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
OSBPL6 Antibody - BSA Free

Product Specs
ItemOSBPL6 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-82475
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
ReactivityHuman
FormatPBS (pH 7.2) and 40% Glycerol
PurityAffinity purified
TargetOSBPL6
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: NEIVRSPRDA SFHIFPSTST AESSPAANVS VMDGKMQPNS FPWQSPLPCS NSLPATCTTG QSKVAAWLQD SEEMDRCAED LAHCQSNLVE
HostRabbit
IsotypeIgG
Antibody TypePrimary Antibodies
ClonalityPolyclonal
Research AreaLipid and Metabolism
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameoxysterol binding protein like 6
NCBI Gene AliasesORP6

Specifications/Features

Available conjugates: Unconjugated

Sequence

NEIVRSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVE

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!