PCYT2 Antibody - BSA Free NBP1-83952 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

PCYT2 Antibody

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83952 (A) shows similar protein distribution across tissues to independent antibody NBP1-83951 (B).
PCYT2 Antibody

PCYT2 Antibody
PCYT2 Antibody

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83952 (A) shows similar protein distribution across tissues to independent antibody NBP1-83951 (B).
PCYT2 Antibody

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83952 (A) shows similar protein distribution across tissues to independent antibody NBP1-83951 (B).
PCYT2 Antibody

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83952 (A) shows similar protein distribution across tissues to independent antibody NBP1-83951 (B).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
PCYT2 Antibody - BSA Free

Product Specs
ItemPCYT2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-83952
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
HostRabbit
TargetPCYT2
ReactivityHu, Rt
IsotypeIgG
ClonalityPolyclonal
Research AreaNeuroscience
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namephosphate cytidylyltransferase 2, ethanolamine
NCBI Gene AliasesET, SPG82
Antibody TypePrimary Antibodies
PurityAffinity purified
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LDKYNCDFCV HGNDITLTVD GRDTYEEVKQ AGRYRECKRT QGVSTTDLVG RMLLVTKAHH SSQEMSSEYR EYADSFGKCP G

Sequence

LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPG

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!