eIF2A Antibody - BSA Free NBP1-84879 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

eIF2A Antibody

Western Blot: eIF2A Antibody [NBP1-84879]
eIF2A Antibody

eIF2A Antibody
eIF2A Antibody

Western Blot: eIF2A Antibody [NBP1-84879] - Analysis in human cell line RPMI-8226.
eIF2A Antibody

Western Blot: eIF2A Antibody [NBP1-84879] - Analysis in human cell line RPMI-8226.
eIF2A Antibody

Western Blot: eIF2A Antibody [NBP1-84879] - Analysis in human cell line RPMI-8226.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
eIF2A Antibody - BSA Free

Product Specs
ItemeIF2A Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-84879
HostRabbit
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: VLVIASTDVD KTGASYYGEQ TLHYIATNGE SAVVQLPKNG PIYDVVWNSS STEFCAVYGF MPAKATIFNL KCDPVFDFGT GPRNA
FormatPBS (pH 7.2) and 40% Glycerol
ApplicationsWB, ICC, IF, IHC, IHC-p
ReactivityHuman (Hu)
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaChromatin Research, DNA Repair, Lipid and Metabolism, Translation Control, Unfolded Protein Response
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesCDA02, EIF-2A, MST089, MSTP004, MSTP089
NCBI Full Gene Nameeukaryotic translation initiation factor 2A
TargeteIF2A

Sequence

VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!