Rhot1 Antibody

Product Specs
ItemRhot1 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $579.00Supplier Page View Company Product Page
Catalog NumberNBP1-89011
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
ReactivityHuman,Rat
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
PurityAffinity purified
TargetRhot1
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: THIVDYSEAE QSDEQLHQEI SQANVICIVY AVNNKHSIDK VTSRWIPLIN ERTDKDSRLP LILVGNKSDL VEYSSMETIL PIMNQYTEIE
HostRabbit
IsotypeIgG
Antibody TypePrimary Antibodies
ClonalityPolyclonal
Research AreaSignal Transduction
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameras homolog family member T1
NCBI Gene AliasesARHT1, MIRO-1, MIRO1

Specifications/Features

Available conjugates: Unconjugated

Sequence

THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Promising Therapeutic Effects of Embryonic Stem Cells-Origin Mesenchymal Stem Cells in Experimental Pulmonary Fibrosis Models: Immunomodulatory and Anti-Apoptotic MechanismsImmune networkDecember 1, 2023Lee H, Jeong OY, Park HJ, Lee SL, Bok EY, Kim M, Suh YS, Cheon YH, Kim HO, Kim S, et al.

(2) MIRO2 Regulates Prostate Cancer Cell Growth via GCN1-Dependent Stress SignalingMolecular cancer research : MCRApril 1, 2022Furnish M, Boulton DP, Genther V, Grofova D, Ellinwood ML, Romero L, Lucia MS, Cramer SD, Caino MC.cultures were used at passage 2 or 3. Antibodies and reagents Antibodies to MIRO1 (Novus, catalog no. NBP1–89011, RRID:AB_11034143, diluted 1:1,000), MIRO2 (Thermo Fisher Scientific, catalog no. PA5–52960, RRID:AB_2646541,

(3) A Nanobody-Based Toolset to Monitor and Modify the Mitochondrial GTPase Miro1Frontiers in molecular biosciencesJanuary 1, 2022Fagbadebo FO, Kaiser PD, Zittlau K, Bartlick N, Wagner TR, Froehlich T, Jarjour G, Nueske S, Scholz A, Traenkle B, et al.purified Miro1 Nbs or AF647 conjugated Nbs (100–200 nM in 5% BSA in TBST) or rabbit anti-Miro1 antibody (# NBP1-89011, Novus Biologicals) was performed overnight at 4°C. Unbound nanobodies were removed by three washing

(4) Miro1 Regulates Activity-Driven Positioning of Mitochondria within Astrocytic Processes Apposed to Synapses to Regulate Intracellular Calcium SignalingThe Journal of neuroscience : the official journal of the Society for NeuroscienceDecember 2, 2015Stephen TL, Higgs NF, Sheehan DF, Al Awabdh S, López-Doménech G, Arancibia-Carcamo IL, Kittler JT.

(5) Mitotic redistribution of the mitochondrial network by Miro and Cenp-FNature communicationsAugust 11, 2015Kanfer G, Courthéoux T, Peterka M, Meier S, Soste M, Melnik A, Reis K, Aspenström P, Peter M, Picotti P, et al.

(6) The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagyNatureJune 19, 2014Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M.

(7) Lysine 27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligaseThe Journal of biological chemistryMay 23, 2014Birsa N, Norkett R, Wauer T, Mevissen TE, Wu HC, Foltynie T, Bhatia K, Hirst WD, Komander D, Plun-Favreau H, et al.

(8) Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cellsNature methodsApril 1, 2013Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E.

(9) VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasisHuman molecular geneticsMarch 15, 2012De Vos KJ, Mórotz GM, Stoica R, Tudor EL, Lau KF, Ackerley S, Warley A, Shaw CE, Miller CC.

Be the First to Write a Review!

Rhot1 Antibody

Rhot1 Antibody

Rhot1 Antibody

Rhot1 Antibody

Rhot1 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Specifications/Features

Sequence

Novus Biologicals, a Bio-Techne Brand

Citations (9)

Reviews

Rhot1 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map