FAM186B Antibody - BSA Free NBP1-88389 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

FAM186B Antibody

Western Blot: FAM186B Antibody [NBP1-88389]
FAM186B Antibody

Western Blot: FAM186B Antibody [NBP1-88389] - Analysis in control (vector only transfected HEK293T lysate) and FAM186B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
FAM186B Antibody

FAM186B Antibody
FAM186B Antibody

Western Blot: FAM186B Antibody [NBP1-88389] - Analysis in control (vector only transfected HEK293T lysate) and FAM186B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
FAM186B Antibody - BSA Free

Product Specs
ItemFAM186B Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-88389
HostRabbit
Quantity0.1 ml (also 25ul)
ReactivityHuman (Hu)
ClonalityPolyclonal
NCBI Gene AliasesC12orf25
NCBI Full Gene Namefamily with sequence similarity 186 member B
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies
PurityAffinity purified
IsotypeIgG
ApplicationsWB, IHC, IHC-p
TargetFAM186B
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: VTMFPKLQLE WNVHLNIPEV TSPKPKKCKL PAASPRHIRP SGPTYKQPFL SRHRACVPLQ MARQQGKQME AVWKTEVASS SYAI

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Sequence

VTMFPKLQLEWNVHLNIPEVTSPKPKKCKLPAASPRHIRPSGPTYKQPFLSRHRACVPLQMARQQGKQMEAVWKTEVASSSYAI

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!