ITPA Antibody - BSA Free NBP1-88296 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

ITPA Antibody

Western Blot: ITPA Antibody [NBP1-88296]
ITPA Antibody

ITPA Antibody
ITPA Antibody

Western Blot: ITPA Antibody [NBP1-88296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
ITPA Antibody

Western Blot: ITPA Antibody [NBP1-88296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
ITPA Antibody

Western Blot: ITPA Antibody [NBP1-88296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
ITPA Antibody - BSA Free

Product Specs
ItemITPA Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-88296
ReactivityHuman (Hu)
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
Research AreaAmino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameinosine triphosphatase
NCBI Gene AliasesC20orf37, DEE35, HLC14-06-P, ITPase, My049, NTPase, dJ794I6.3
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: GFEDKSAYAL CTFALSTGDP SQPVRLFRGR TSGRIVAPRG CQDFGWDPCF QPDGYEQTYA EMPKAEKNAV SHRFRALLEL QEYFGSLAA
HostRabbit
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
TargetITPA
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

Sequence

GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!