c-Myc-responsive protein Rcl Antibody - BSA Free NBP1-85181 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

c-Myc-responsive protein Rcl Antibody

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Analysis in control (vector only transfected HEK293T lysate) and DNPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
c-Myc-responsive protein Rcl Antibody

c-Myc-responsive protein Rcl Antibody
c-Myc-responsive protein Rcl Antibody

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Analysis in control (vector only transfected HEK293T lysate) and DNPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
c-Myc-responsive protein Rcl Antibody

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Analysis in control (vector only transfected HEK293T lysate) and DNPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
c-Myc-responsive protein Rcl Antibody

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Analysis in control (vector only transfected HEK293T lysate) and DNPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
c-Myc-responsive protein Rcl Antibody - BSA Free

Product Specs
Itemc-Myc-responsive protein Rcl Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-85181
ReactivityHuman
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
Targetc-Myc-responsive protein Rcl
HostRabbit
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MAAAMVPGRS ESWERGEPGR PALYFCGSIR GGREDRTLYE RIVSRLRRFG TVLTEHV
IsotypeIgG
ClonalityPolyclonal
NCBI Gene AliasesC6orf108, RCL, dJ330M21.3
NCBI Full Gene Name2'-deoxynucleoside 5'-phosphate N-hydrolase 1
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Research AreaCell Biology, Cell Cycle and Replication
Antibody TypePrimary Antibodies
PurityAffinity purified

Sequence

MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!