Integrin beta 8 Antibody - BSA Free NBP1-87539 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Integrin beta 8 Antibody

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Analysis in human cervix, uterine and liver tissues using NBP1-87539 antibody. Corresponding Integrin beta 8 RNA-seq data are presented for the same tissues.
Integrin beta 8 Antibody

Integrin beta 8 Antibody
Integrin beta 8 Antibody

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Analysis in human cervix, uterine and liver tissues using NBP1-87539 antibody. Corresponding Integrin beta 8 RNA-seq data are presented for the same tissues.
Integrin beta 8 Antibody

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Analysis in human cervix, uterine and liver tissues using NBP1-87539 antibody. Corresponding Integrin beta 8 RNA-seq data are presented for the same tissues.
Integrin beta 8 Antibody

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Analysis in human cervix, uterine and liver tissues using NBP1-87539 antibody. Corresponding Integrin beta 8 RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Integrin beta 8 Antibody - BSA Free

Product Specs
ItemIntegrin beta 8 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-87539
ApplicationsIHC, IHC-p
ReactivityHuman (Hu)
ClonalityPolyclonal
PurityAffinity purified
Research AreaSignal Transduction
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameintegrin subunit beta 8
IsotypeIgG
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQ VCSGRGTCVC GRCECTDPRS IGRFCEHCPT CYTACKENWN CMQCLHPHNL SQAILDQCKT SCALMEQQHY
HostRabbit
TargetIntegrin beta 8
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated

Specifications/Features

Available conjugates: Unconjugated

Sequence

AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!