SGLT2/SLC5A2 Antibody

Product Specs
ItemSGLT2/SLC5A2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $579.00Supplier Page View Company Product Page
Catalog NumberNBP1-92384
ReactivityHuman,Mouse
Quantity0.1 ml (also 25ul)
ApplicationsIF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
HostRabbit
FormatPBS (pH 7.2) and 40% Glycerol
Antibody TypePrimary Antibodies
NCBI Full Gene Namesolute carrier family 5 member 2
NCBI Gene AliasesSGLT2
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Research AreaApoptosis, Cancer, Tumor Suppressors
PurityAffinity purified
ClonalityPolyclonal
IsotypeIgG
TargetSGLT2/SLC5A2
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: FHEVGGYSGL FDKYLGAATS LTVSEDPAVG NISSFCYRPR PDSYHLL
Conjugate/TagUnconjugated

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Sequence

FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL

Questions and Answers

What species has the SGLT2/SLC5A2 antibody been shown to work with in immunohistochemistry?

The SGLT2/SLC5A2 antibody has been shown to work in immunohistochemistry with human and mouse tissues, specifically recognizing amino acid residues 220–266 of human SGLT2/SLC5A2, as demonstrated in studies involving paraffin-embedded sections from human brains and mouse kidneys .

Can this antibody be used to study SGLT2 expression in cancer research?

Yes, the SGLT2/SLC5A2 antibody has been utilized in cancer research, particularly in studies investigating its expression in pancreatic cancer. Although SGLT2 was not significantly overexpressed in pancreatic ductal adenocarcinoma compared to adjacent normal tissue, it was included in analyses assessing the role of sodium glucose transporters in cancer .

Is there any evidence of SGLT2's role in brain function or pathology?

Yes, recent studies have indicated that SGLT2 is expressed in the choroid plexus and ependymal cells of the brain, suggesting a potential role in brain function and pathology, particularly in relation to Alzheimer's disease and diabetes mellitus . The SGLT2 inhibitors may also have implications for brain health, as they are being explored for their effects on brain function .

How has the SGLT2/SLC5A2 antibody been validated in scientific research?

The SGLT2/SLC5A2 antibody has undergone independent validation for specificity in various studies, including those analyzing its expression in mouse kidney and lung tissues. It has been used successfully in immunohistochemistry and has shown distinct immunoreactive bands in relevant tissue analyses .

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Sex-specific proximal tubular cell differentiation pathways identified by single-nucleus RNA sequencingScientific ReportsOctober 14, 2024Yueh-An Lu, Tanya Smith, Sumukh Deshpande, Chia-Te Liao, Bnar Talabani, Irina Grigorieva, Anna Mason, Robert Andrews, Timothy Bowen, Philip R. Taylor, et al.for 30 min and with 10% goat serum for an hour. Primary antibodies included anti-SLC5A2 (Biotechne, NBP1-92384), SLC13A3 (Biotechne, NBP1-82602), SLC5A10 (Biotechne, NBP2-13341) and Ki67 (Biotechne, NBP2-22112).

(2) Inhibition of the glucose transporter SGLT2 with dapagliflozin in pancreatic alpha cells triggers glucagon secretionNature medicineJanuary 1, 0001"Bonner C, Kerr-Conte J, Gmyr V, Queniat G, Moerman E, Thévenet J, Beaucamps C, Delalleau N, Popescu I, Malaisse WJ, et al."

(3) Impact of Pals1 on Expression and Localization of Transporters Belonging to the Solute Carrier FamilyFrontiers in molecular biosciencesJanuary 1, 0001"Berghaus C, Groh AC, Breljak D, Ciarimboli G, Sabolić I, Pavenstädt H, Weide T."against Slc34a3 (Aviva Systems Biology Corporation, ARP32173 P050, 1:500), Slc5a2 (Novus Biologicals, NBP1-92384, 1:500) and Slc16a14 (Sigma-Aldrich, HPA040518, 1:500). As loading control we used mAb against α-Actinin-4

(4) A Comparison Between GalT(-/-);hCD39;hCD55 and GalT(-/-);hCD39;hCD46;hCD55;TBM Pig Kidneys Transplanted in Nonhuman PrimatesCell transplantationJanuary 1, 0001"Suh HN, Lee JY, Kang HJ, Park EM, Yun IJ, Kim WS, Choi K, Hwang JH."sodium-glucose linked cotransporter (SGLT1; cat. no. 07-1417; 1:2000 dilution; Millipore), SGLT2 (cat. no. NBP1-92384; 1:500 dilution; Novus, CO, USA), vimentin (cat. no. 5743; 1:250 dilution; Cell signaling, MA, USA),

(5) Sodium/glucose cotransporter 2 is expressed in choroid plexus epithelial cells and ependymal cells in human and mouse brainsNeuropathology : official journal of the Japanese Society of NeuropathologyJanuary 1, 0001"Chiba Y, Sugiyama Y, Nishi N, Nonaka W, Murakami R, Ueno M."for 30 min, the sections were incubated with a rabbit polyclonal anti‐SGLT2/SLC5A2 antibody (1:400, NBP1‐92384, Novus Biologicals, Centennial, CO, USA), which specifically recognized amino acid residues 220–266

(6) Sodium-glucose transporter 2 is a diagnostic and therapeutic target for early-stage lung adenocarcinomaScience translational medicineJanuary 1, 0001"Scafoglio CR, Villegas B, Abdelhady G, Bailey ST, Liu J, Shirali AS, Wallace WD, Magyar CE, Grogan TR, Elashoff D, et al."two different antibodies were used: Abcam ab85626 (1:1000) for mouse tissues, and Novus Biologicals NBP1–92384 (1:250) for human and mouse tissues. The antigenic peptide for the Novus antibody is FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL;

(7) Evaluation of the efficacy of Abelmoschus manihot (L.) on diabetic nephropathy by analyzing biomarkers in the glomeruli and proximal and distal convoluted tubules of the kidneysFrontiers in pharmacologyJanuary 1, 0001"Yu H, Wang M, Yu J, Tang H, Xu Q, Cheng N, Luo X, Wang Y, Ge H, Qiang L, et al."antibodies include col4a3 (1:50 diluted, orb313870, Biorbyt Biologicals, China), slc5a2 (1:100 diluted, NBP1-92384, Novus Biologicals, China), slc34a1 (1:100 diluted, orb499592, Biorbyt Biologicals, China), slc12a3

(8) Dapagliflozin Does Not Directly Affect Human α or β CellsEndocrinologyJanuary 1, 0001"Dai C, Walker JT, Shostak A, Bouchi Y, Poffenberger G, Hart NJ, Jacobson DA, Calcutt MW, Bottino R, Greiner DL, et al."

(9) SGLT1/2 inhibition improves glycemic control and multi-organ protection in type 1 diabetesiScienceJanuary 1, 0001"Herat LY, Matthews JR, Hibbs M, Rakoczy EP, Schlaich MP, Matthews VB."Melbourne, Australia",NBP220338 Rabbit anti-SGLT2 Antibody,"Novus Biologicals, Littleton, CO, USA",NBP192384; RRID:AB_11027910 Mouse anti-SGLT2 Antibody,"Santa Cruz Biotechnology, Santa Cruz, CA, USA",sc-393350;

(10) The expression and survival significance of sodium glucose transporters in pancreatic cancerBMC cancerJanuary 1, 0001"Du J, Gu J, Deng J, Kong L, Guo Y, Jin C, Bao Y, Fu D, Li J."Incubation with primary antibodies (Abcam ab15309 (1:200), Abcam ab14685 (1:200), Novus Biologicals NBP1–92384 (1:250) and Abcam ab85626 (1:250)) was performed overnight at 4 °C. After washing 3 times, the samples

(11) "Canagliflozin, an Inhibitor of the Na(+)-Coupled D-Glucose Cotransporter, SGLT2, Inhibits Astrocyte Swelling and Brain Swelling in Cerebral Ischemia"CellsJanuary 1, 0001"Shim B, Stokum JA, Moyer M, Tsymbalyuk N, Tsymbalyuk O, Keledjian K, Ivanova S, Tosun C, Gerzanich V, Simard JM."validation. We studied SGLT2 expression using a commercial rabbit polyclonal anti-SGLT2 antibody (#NBP1-92384; Novus Biologicals, Centennial, CO, USA). This antibody was independently validated previously [35],

(12) "Higher pNRF2, SOCS3, IRF3, and RIG1 Tissue Protein Expression in NASH Patients versus NAFL Patients: pNRF2 Expression Is Concomitantly Associated with Elevated Fasting Glucose Levels"Journal of personalized medicineJanuary 1, 0001"Schwertheim S, Alhardan M, Manka PP, Sowa JP, Canbay A, Schmidt HH, Baba HA, Kälsch J."anti-syntaxin (#HPA001204, Sigma-Aldrich, Steinheim, Germany; diluted 1:200 for 60 min at RT); anti-SGLT2 (#NBP1-92384, Novus; diluted 1:50 for 30 min at RT); and anti-SOCS3 (#ab280884, Abcam, Cambridge, UK; diluted 1:100

(13) "Glucose, Fructose, and Urate Transporters in the Choroid Plexus Epithelium"International journal of molecular sciencesJanuary 1, 0001"Chiba Y, Murakami R, Matsumoto K, Wakamatsu K, Nonaka W, Uemura N, Yanase K, Kamada M, Ueno M."immunohistochemical staining (a,b)(ab14685, SGLT1 Figure microphotographs of immunohistochemical staining for (a,b)for SGLT1 (ab14685, Abcam) [55], (c,d) SGLT2 (NBP1-92384, Novus Biologicals, Centennial, CO, USA) [55], and Abcam) [55], (c,d) SGLT2 (NBP1-92384, Novus Biologicals,

(14) Cyst formation in proximal renal tubules caused by dysfunction of the microtubule minus-end regulator CAMSAP3Scientific reportsJanuary 1, 0001"Mitsuhata Y, Abe T, Misaki K, Nakajima Y, Kiriya K, Kawasaki M, Kiyonari H, Takeichi M, Toya M, Sato M."anti-SGLT1 (M-19; Santa Cruz Biotechnology, sc-20582, 1:200), rabbit anti-SGLT2 (Novus Biologicals, NBP1-92384, 1:200), mouse anti-ezrin (3C12; abcam, ab4069, 1:500), rabbit anti-giantin (Covance, PRB-114C, 1:700),

Be the First to Write a Review!