EB2 Antibody - BSA Free NBP1-84926 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

EB2 Antibody

Western Blot: EB2 Antibody [NBP1-84926]
EB2 Antibody

EB2 Antibody
EB2 Antibody

Western Blot: EB2 Antibody [NBP1-84926] - Analysis in human cell lines A-549 and A-431 using Anti-MAPRE2 antibody. Corresponding MAPRE2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
EB2 Antibody

Western Blot: EB2 Antibody [NBP1-84926] - Analysis in human cell lines A-549 and A-431 using Anti-MAPRE2 antibody. Corresponding MAPRE2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
EB2 Antibody

Western Blot: EB2 Antibody [NBP1-84926] - Analysis in human cell lines A-549 and A-431 using Anti-MAPRE2 antibody. Corresponding MAPRE2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
EB2 Antibody - BSA Free

Product Specs
ItemEB2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-84926
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin
TargetEB2
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: KFYDANYDGK EYDPVEARQG QDAIPPPDPG EQIFNLPKKS HHANSPTAGA AKSSPAAKPG STPSRPSSAK
ReactivityHuman (Hu)
IsotypeIgG
ClonalityPolyclonal
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namemicrotubule associated protein RP/EB family member 2
NCBI Gene AliasesCSCSC2, EB1, EB2, RP1
Research AreaCell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction
PurityAffinity purified
HostRabbit
FormatPBS (pH 7.2) and 40% Glycerol

Sequence

KFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAK

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!