c-Myc-responsive protein Rcl Antibody - BSA Free NBP1-85180 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

c-Myc-responsive protein Rcl Antibody

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Analysis in human duodenum and testis tissues. Corresponding c-Myc-responsive protein Rcl RNA-seq data are presented for the same tissues.
c-Myc-responsive protein Rcl Antibody

c-Myc-responsive protein Rcl Antibody
c-Myc-responsive protein Rcl Antibody

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Analysis in human duodenum and testis tissues. Corresponding c-Myc-responsive protein Rcl RNA-seq data are presented for the same tissues.
c-Myc-responsive protein Rcl Antibody

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Analysis in human duodenum and testis tissues. Corresponding c-Myc-responsive protein Rcl RNA-seq data are presented for the same tissues.
c-Myc-responsive protein Rcl Antibody

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Analysis in human duodenum and testis tissues. Corresponding c-Myc-responsive protein Rcl RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
c-Myc-responsive protein Rcl Antibody - BSA Free

Product Specs
Itemc-Myc-responsive protein Rcl Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-85180
ReactivityHuman
Targetc-Myc-responsive protein Rcl
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml
HostRabbit
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: QPSLGVGYEL GRAVAFNKRI LCLFRPQSGR VLSAMIRGAA DGSRFQVWDY EEGEVEALLD RYFEADPPGQ
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaCell Biology, Cell Cycle and Replication
NCBI Gene AliasesC6orf108, RCL, dJ330M21.3
NCBI Full Gene Name2'-deoxynucleoside 5'-phosphate N-hydrolase 1
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies

Sequence

QPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQ

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!