OSBPL2 Antibody

Product Specs
ItemOSBPL2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-92236
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MNGEEEFFDA VTGFDSDNSS GEFSEANQKV TGMIDLDTSK NNRIGKTGER PSQENGIQKH RT
TargetOSBPL2
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
ApplicationsWB, ICC, IF, IHC, IHC-p, IP
ReactivityHuman (Hu)
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaLipid and Metabolism
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameoxysterol binding protein like 2
NCBI Gene AliasesDFNA67, DNFA67, ORP-2, ORP2

Sequence

MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRT

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) OSBPL2 mutations impair autophagy and lead to hearing loss, potentially remedied by rapamycinAutophagyNovember 1, 2022Koh YI, Oh KS, Kim JA, Noh B, Choi HJ, Joo SY, Rim JH, Kim HY, Kim DY, Yu S, et al.

(2) ORP2 couples LDL-cholesterol transport to FAK activation by endosomal cholesterol/PI(4,5)P₂ exchangeThe EMBO journalJuly 15, 2021Takahashi K, Kanerva K, Vanharanta L, Almeida-Souza L, Lietha D, Olkkonen VM, Ikonen E.clone N29 for Western blotting), PI(4,5)P2 (Echelon, Z‐G045, clone 2C11), ORP2 (Novus Biologicals, NBP1‐92236), NPC1 (Abcam, ab134113), Lamp1 (DSHB, H4A3), GFP (Abcam, ab290 and ab1218); see Appendix␣Fig S1 for

(3) A Combined Model of Human iPSC-Derived Liver Organoids and Hepatocytes Reveals Ferroptosis in DGUOK Mutant mtDNA Depletion SyndromeAdvanced science (Weinheim, Baden-Wurttemberg, Germany)May 1, 2021Guo J, Duan L, He X, Li S, Wu Y, Xiang G, Bao F, Yang L, Shi H, Gao M, et al.

Be the First to Write a Review!

OSBPL2 Antibody

OSBPL2 Antibody

OSBPL2 Antibody

OSBPL2 Antibody

OSBPL2 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (3)

Reviews

OSBPL2 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map