POU2F3 Antibody

Product Specs
ItemPOU2F3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-83966
ReactivityHuman (Hu)
NCBI Gene AliasesEpoc-1, OCT-11, OCT11, OTF-11, PLA-1, PLA1, Skn-1a
NCBI Full Gene NamePOU class 2 homeobox 3
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies
PurityAffinity purified
ClonalityPolyclonal
IsotypeIgG
ApplicationsWB, IF, IHC, IHC-p
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LESMHTDIKM SGDVADSTDA RSTLSQVEPG NDRNGLDFNR QIKTEDLSDS LQQTLSHRPC HLSQGPAMMS GNQMSGLNAS PCQDMASLHP LQQLVLVPGH LQSVSQFLLS QTQP
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
TargetPOU2F3
HostRabbit

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Sequence

LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) MET pathway inhibition increases chemo-immunotherapy efficacy in small cell lung cancerCell reports. MedicineJuly 15, 2025Del Rey-Vergara R, Galindo-Campos MA, Rocha P, Carpes M, Martínez C, Masfarré L, Menéndez S, Quimis F, Rossell A, Iñañez A, et al.ASCL1 (556604; RRID:AB_396479, BD Biosciences), NEUROD1 (ab213725; RRID:AB_2801303, Abcam), and POU2F3 (NBP1-83966; RRID:AB_11024500, Novus). Staining conditions for each antibody are summarized in Table S5. Samples

(2) Immune profiling identifies CD161(+)CD127(+)CD8(+) T cells as a predictive biomarker for Anti-PD-L1 therapy response in the SCLC-I subtypeJournal of translational medicineJuly 1, 2025Qu J, Sun W, Li Y, Cai Z, Wu B, Shen Q, Chen L, Wang B, Ying L, Xie C, et al.primary antibodies: ASCL1 (556604, BD Biosciences, 1:100), NEUROD1(ab213725, Abcam, 1:250), POU2F3 (NBP1-83966, Novus Biologicals, 1:400), CD3 (17617-1-AP, Proteintech, 1:200), and CD8 (ab237709, Abcam, 1:200). Marker

(3) Potential of C-X-C-Chemokine-Receptor-Type-4-Directed PET/CT Using [¹⁸F]AlF-NOTA-QHY-04 in Identifying Molecular Subtypes of Small Cell Lung CancerKorean J RadiolMay 14, 2025Yuxi Luo, Kai Cheng, Jingru Liu, Jinli Pei, Shengnan Xu, Xinzhi Zhao, Shijie Wang, Kunlong Zhao, Wanhu Li, Jie Liu, et al.1:25), NEUROD1 (Clone: EPR20766, Cat# ab213725, Abcam, 1:1000), and POU2F3 (Clone: polyclonal, Cat# NBP1-83966, Novus Biologicals, 1:200) was performed on formalin-fixed paraffin-embedded tissue sections (4–5 µm)

(4) The Potential of Single-Transcription Factor Gene Expression by RT-qPCR for Subtyping Small Cell Lung CancerInternational journal of molecular sciencesFebruary 3, 2025Iñañez A, Del Rey-Vergara R, Quimis F, Rocha P, Galindo M, Menéndez S, Masfarré L, Sánchez I, Carpes M, Martínez C, et al.(A5316, Merck Life Science, Boston, MA, USA), ASCL1 (556604, BD), NEUROD1 (ab213725, Abcam) and POU2F3 (NBP1-83966, Novus). Densitometry for the quantitative analysis of protein expression was performed with ImageJ

(5) ATAD2 is a potential immunotherapy target for patients with small cell lung cancer harboring HLA-A∗0201EBioMedicineJanuary 13, 2025Li Yuan, Sini Li, Yixiang Zhu, Lin Yang, Xue Zhang, Yan Qu, Zhijie Wang, Jianchun Duan, Jia Zhong, Yanhua Tian, et al.anti-Mash1/achaete-scute homolog (Abcam, ab211327), anti-NeuroD1 (Abcam, ab213725), anti-Pou2f3 (Novus Biologicals, NBP1-83966), anti-YAP1 (Abcam, ab205270), and anti-ATAD2 (Cell Signaling Technology, 50563) were used. The slides

(6) Alterations in cellular metabolic pathway and epithelial cell maturation induced by MYO5B defects are partially reversible by LPAR5 activationAmerican Journal of Physiology-Gastrointestinal and Liver PhysiologyDecember 1, 2024Michael Momoh, Sudiksha Rathan-Kumar, Andreanna Burman, Monica E. Brown, Francisca Adeniran, Cynthia Ramos, James R. Goldenring, Joseph T. Roland, Izumi Kajiwith the primary antibodies against phosphor Girdin (1:100, IBL 28143) (30) or POU2F3 (1:200, Novus NBP1-83966) diluted with the blocking solution for 2 days at 4°C. After rinsing in PBS with 0.3% Triton X-100,

(7) Molecular subtypes of neuroendocrine carcinomas: A cross-tissue classification framework based on five transcriptional regulatorsCancer cellJune 10, 2024Wang Z, Liu C, Zheng S, Yao Y, Wang S, Wang X, Yin E, Zeng Q, Zhang C, Zhang G, et al.

(8) Comprehensive analysis of transcription factor-based molecular subtypes and their correlation to clinical outcomes in small-cell lung cancerEBioMedicineApril 1, 2024Park S, Hong TH, Hwang S, Heeke S, Gay CM, Kim J, Jung HA, Sun JM, Ahn JS, Ahn MJ, et al.EPR20766, Abcam, Cat# ab213725, RRID:AB_2801303, 1:250) and POU2F3 (Polyclonal, Novus Biologicals, Cat# NBP1-83966, RRID:AB_11024500, 1:200) were processed on the VENTANA BenchMark ULTRA system, using CC1 solution for

(9) Molecular Subtypes and Tumor Microenvironment Characteristics of Small-Cell Lung Cancer Associated with Platinum-ResistanceCancersJuly 11, 2023Kim J, Kim S, Park SY, Lee GK, Lim KY, Kim JY, Hwang JA, Yu N, Kang EH, Hwang M, et al.Abcam, Cambridge, UK; NEUROD1:1:4000; Clone IMR-32, Abcam, Cambridge, UK; POU2F3:1:50, polyclonal, NBP1-83966, Novus Biologicals, Centennial, CO, USA) were incubated for 32 min at 42 °C and detected using the Ultra-View

(10) Whole-Section Landscape Analysis of Molecular Subtypes in Curatively Resected Small Cell Lung Cancer: Clinicopathologic Features and Prognostic SignificanceModern pathology : an official journal of the United States and Canadian Academy of Pathology, IncJuly 1, 2023Hwang S, Hong TH, Kim HK, Choi YS, Zo JI, Shim YM, Han J, Chan Ahn Y, Pyo H, Noh JM, et al.

(11) Single-cell transcriptomic profiling reveals the tumor heterogeneity of small-cell lung cancerSignal transduction and targeted therapyOctober 5, 2022Tian Y, Li Q, Yang Z, Zhang S, Xu J, Wang Z, Bai H, Duan J, Zheng B, Li W, et al.of SCLC, including ASCL1 (Abcam, ab211327), NEUROD1 (Abcam, ab60704) and POU2F3 (Novus Biologicals, NBP1–83966). Multiplex immunofluorescence staining was performed using a PANO 7-plex IHC kit (Panovue, Cat# 0004100100),

(12) Molecular subtypes of small cell lung cancer transformed from adenocarcinoma after EGFR tyrosine kinase inhibitor treatmentTranslational lung cancer researchNovember 1, 2021Hwang S, Hong TH, Park S, Jung HA, Sun JM, Ahn JS, Ahn MJ, Park K, Choi YL, Lee SH.BD Biosciences, 1:25), NEUROD1 (Clone EPR20766, Cat# ab213725, Abcam, 1:250), POU2F3 (polyclonal, Cat# NBP1-83966, Novus Biologicals: 1:200), YAP1 (Clone 2F12, Cat# ab56701, Abcam, 1:200), RB1 (Clone 4H1, Cat# 9309,

(13) Cell-autonomous immune gene expression is repressed in pulmonary neuroendocrine cells and small cell lung cancerCommunications biologyMarch 9, 2021Cai L, Liu H, Huang F, Fujimoto J, Girard L, Chen J, Li Y, Zhang YA, Deb D, Stastny V, et al.(dilution 1:100; Clone EPR20766, Abcam, ab213725), POU2F3 (dilution 1:200; polyclonal, Novus Biologicals, NBP1-83966), CD4 (dilution 1:80; Leica Biosystems, CD4-368-L-CE-H) and CD8 (dilution 1:25; Thermo Scientific, MS-457s)

(14) Patterns of transcription factor programs and immune pathway activation define four major subtypes of SCLC with distinct therapeutic vulnerabilitiesCancer cellMarch 8, 2021Gay CM, Stewart CA, Park EM, Diao L, Groves SM, Heeke S, Nabet BY, Fujimoto J, Solis LM, Lu W, et al.Jose, CA; NEUROD1: 1:100 Clone EPR20766, ab213725, Abcam, Cambridge, UK; and POU2F3: 1:200, polyclonal, NBP1–83966, Novus Biologicals, Centennial, CO, USA; Vimentin: 1:100, Clone D21H3, 5741, Cell Signaling Technology,

Be the First to Write a Review!

POU2F3 Antibody

POU2F3 Antibody

POU2F3 Antibody

POU2F3 Antibody

POU2F3 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Specifications/Features

Sequence

Novus Biologicals, a Bio-Techne Brand

Citations (14)

Reviews

POU2F3 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map