GPRC5A/RAI3 Antibody

Product Specs
ItemGPRC5A/RAI3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $579.00Supplier Page View Company Product Page
Catalog NumberNBP1-89743
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry Free-Floating,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LTKQRNPMDY PVEDAFCKPQ LVKKSYGVEN RAYSQEEITQ GFEETGDTLY APYSTHFQLQ NQPPQKEFSI PR
ReactivityHuman
Quantity0.1 ml (also 25ul)
TargetGPRC5A/RAI3
Conjugate/TagUnconjugated
HostRabbit
IsotypeIgG
ClonalityPolyclonal
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesGPCR5A, PEIG-1, RAI3, RAIG1, TIG1
NCBI Full Gene NameG protein-coupled receptor class C group 5 member A
Antibody TypePrimary Antibodies
Research AreaGPCR
PurityAffinity purified

LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR

Available conjugates: Unconjugated

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

(1) The Effect of GPRC5a on the Proliferation, Migration Ability, Chemotherapy Resistance, and Phosphorylation of GSK-3β in Pancreatic CancerInternational journal of molecular sciencesJune 26, 2018Liu B, Yang H, Pilarsky C, Weber GF.gel and proteins were transferred to a nitrocellulose membrane. As primary antibodies, GPRC5a (NOVUS, NBP1-89743, Littleton, CO, USA), phosphorylation -GSK-3β (Cell Signaling, #5558, Danvers, MA, USA ), GSK-3β (Cell Signaling

(2) The G Protein-Coupled Receptor RAI3 Is an Independent Prognostic Factor for Pancreatic Cancer Survival and Regulates Proliferation via STAT3 PhosphorylationPloS oneJanuary 1, 2017Jahny E, Yang H, Liu B, Jahnke B, Lademann F, Knösel T, Rümmele P, Grützmann R, Aust DE, Pilarsky C, et al.peroxidase was blocked and the incubation with RAI3 antibody (1:400, Novus Biologicals, Wiesbaden, NBP1-89743) followed. The detection was performed using UltraView Universal DAB Detection Kit (Ventana). Finally,

GPRC5A/RAI3 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand