RNF187 Antibody

Product Specs
ItemRNF187 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-91025
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetRNF187
ApplicationsIF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Quantity0.1 ml (also 25ul)
HostRabbit
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: HVMDRRKKAL TDYKKLRAFF VEEEEHFLQE AEKEEGLPED ELADPTERFR SLLQAVSELE KKHRNLGLSM LLQ
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namering finger protein 187
NCBI Gene AliasesRACO-1, RACO1

Sequence

HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) A mitochondria-driven quality control mechanism for peroxisomal membrane proteinsNature CommunicationsJune 10, 2026Sarin Segev-Nakar, Itay Koren#27472-1-AP), rabbit anti-PEX16 (Proteintech #14816-1-AP), rabbit anti- RNF187 (Novus Biologicals, #NBP1-91025), mouse anti-Catalase (R&D Systems, # MAB3398). In vivo ubiquitination analysis HEK293T cells stably

(2) RING finger protein 187 as a novel potential biomarker for predicting the prognosis of ovarian carcinoma in 2 cancer centersCurrent problems in cancerJanuary 1, 0001"Chen J, Chen K, Zhou Z, Huang L, Cai Y, Tu H, Zhang X."

(3) The E3 ubiquitin ligase Trim7 mediates c-Jun/AP-1 activation by Ras signallingNature communicationsJanuary 1, 0001"Chakraborty A, Diefenbacher ME, Mylona A, Kassel O, Behrens A."

(4) High level of RNF187 contributes to the progression and drug resistance of osteosarcomaJournal of CancerJanuary 1, 0001"Wan WB, Wu K, Peng K, Qiu ZQ, Duan ZB, Chen X, Xu ZM, Cheng K, Zhao JM, Shi QM."

Be the First to Write a Review!

RNF187 Antibody

RNF187 Antibody

RNF187 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (4)

Reviews

RNF187 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map