RanBP3 Antibody - BSA Free NBP1-92315 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RanBP3 Antibody

Western Blot: RanBP3 Antibody [NBP1-92315]
RanBP3 Antibody

RanBP3 Antibody
RanBP3 Antibody

Western Blot: RanBP3 Antibody [NBP1-92315] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
RanBP3 Antibody

Western Blot: RanBP3 Antibody [NBP1-92315] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
RanBP3 Antibody

Western Blot: RanBP3 Antibody [NBP1-92315] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RanBP3 Antibody - BSA Free

Product Specs
ItemRanBP3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-92315
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: KSIRITAMDT EDQGVKVFLI SASSKDTGQL YAALHHRILA LRSRVEQEQE AKMPAPEPGA APSNEEDDSD D
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
ReactivityHuman
TargetRanBP3
HostRabbit
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaSignal Transduction
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameRAN binding protein 3

Sequence

KSIRITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDD

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!