RBM26 Antibody - BSA Free NBP1-89007 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RBM26 Antibody

Western Blot: RBM26 Antibody [NBP1-89007]
RBM26 Antibody

RBM26 Antibody
RBM26 Antibody

Western Blot: RBM26 Antibody [NBP1-89007] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
RBM26 Antibody

Western Blot: RBM26 Antibody [NBP1-89007] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
RBM26 Antibody

Western Blot: RBM26 Antibody [NBP1-89007] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RBM26 Antibody - BSA Free

Product Specs
ItemRBM26 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-89007
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: PPLTPLQPSG MDAPPNSATS SVPTVVTTGI HHQPPPAPPS LFTADTYDTD GY
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
HostRabbit
Conjugate/TagUnconjugated
TargetRBM26
Quantity0.1 ml (also 25ul)
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
Research AreaCell Biology
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameRNA binding motif protein 26
NCBI Gene AliasesARRS2, C13orf10, PPP1R132, PRO1777, SE70-2, ZC3H17

Sequence

PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!