PDILT Antibody - BSA Free NBP1-80933 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

PDILT Antibody

Western Blot: PDILT Antibody [NBP1-80933]
PDILT Antibody

PDILT Antibody
PDILT Antibody

Western Blot: PDILT Antibody [NBP1-80933] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
PDILT Antibody

Western Blot: PDILT Antibody [NBP1-80933] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
PDILT Antibody - BSA Free

Product Specs
ItemPDILT Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-80933
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ReactivityHuman
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: VSSIHITKPV HILEERSLLV LTPAGLTQML NQTRFLMVLF HNPSSKQSRN LAEELGKAVE IMGKGKNGIG FGKVDITIEK ELQQEFGI
TargetPDILT
Conjugate/TagUnconjugated
HostRabbit
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameprotein disulfide isomerase like, testis expressed
NCBI Gene AliasesPDIA7

Sequence

VSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGI

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!