LEDGF Antibody - BSA Free NBP1-87885 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

LEDGF Antibody

Immunocytochemistry/Immunofluorescence: LEDGF Antibody [NBP1-87885] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
LEDGF Antibody

LEDGF Antibody
LEDGF Antibody

Immunocytochemistry/Immunofluorescence: LEDGF Antibody [NBP1-87885] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
LEDGF Antibody

Immunocytochemistry/Immunofluorescence: LEDGF Antibody [NBP1-87885] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
LEDGF Antibody

Immunocytochemistry/Immunofluorescence: LEDGF Antibody [NBP1-87885] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
LEDGF Antibody - BSA Free

Product Specs
ItemLEDGF Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-87885
HostRabbit
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: KQVETEEAGV VTTATASVNL KVSPKRGRPA ATEVKIPKPR GRPKMVKQPC PSESDIITEE DKSKKKGQEE KQPKKQPKKD EEGQ
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
TargetLEDGF
ReactivityHuman (Hu)
IsotypeIgG
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesDFS70, LEDGF, PAIP, PSIP2, p52, p75
NCBI Full Gene NamePC4 and SRSF1 interacting protein 1
Antibody TypePrimary Antibodies
Research AreaABC Transporters, Alzheimers Research, Neuroscience
PurityAffinity purified
ClonalityPolyclonal
FormatPBS (pH 7.2) and 40% Glycerol

Sequence

KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!