TSGA2 Antibody

Product Specs
ItemTSGA2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-89839
HostRabbit
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ReactivityHuman,Mouse
TargetTSGA2
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: TAELIHLNHR YQGKFLNKNP VGPGKYVFDV GCEQHGEYRL TDMERGEEEE EEELVTVVPK WKATQITELA LWTPTL
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaCell Cycle and Replication
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameradial spoke head component 1
NCBI Gene AliasesCT79, RSP44, RSPH10A, TSA2, TSGA2

Sequence

TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Promoter Deletion Leading to Allele Specific Expression in a Genetically Unsolved Case of Primary Ciliary DyskinesiaAmerican Journal of Medical Genetics Part AFebruary 1, 2025M. Makenzie Beaman, Weining Yin, Amanda J. Smith, Patrick R. Sears, Margaret W. Leigh, Thomas W. Ferkol, Brendan Kearney, Kenneth N. Olivier, Adam J. Kimple, Shannon Clarke, et al.(Novus Biologicals NBP2–50301) at a 1:1,000 dilution and rabbit anti-RSPH1 primary antibody (Novus Biologicals NBP1–89839) at a 1:1,000 dilution in blocking solution. Membranes were then washed with 1X TBST (0.1% Tween 20)

(2) Mice with a Deletion of Rsph1 Exhibit a Low Level of Mucociliary Clearance and Develop a Primary Ciliary Dyskinesia PhenotypeAmerican journal of respiratory cell and molecular biologyJanuary 1, 0001"Yin W, Livraghi-Butrico A, Sears PR, Rogers TD, Burns KA, Grubb BR, Ostrowski LE."

(3) Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defectsHuman molecular geneticsJanuary 1, 0001"Onoufriadis A, Shoemark A, Schmidts M, Patel M, Jimenez G, Liu H, Thomas B, Dixon M, Hirst RA, Rutman A, et al."

(4) Loss-of-function mutations in RSPH1 cause primary ciliary dyskinesia with central-complex and radial-spoke defectsAmerican journal of human geneticsJanuary 1, 0001"Kott E, Legendre M, Copin B, Papon JF, Dastot-Le Moal F, Montantin G, Duquesnoy P, Piterboth W, Amram D, Bassinet L, et al."

(5) Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagellaCell reportsJanuary 1, 0001"Zhang X, Xiao Z, Zhang J, Xu C, Liu S, Cheng L, Zhou S, Zhao S, Zhang Y, Wu J, et al."

Be the First to Write a Review!

TSGA2 Antibody

TSGA2 Antibody

TSGA2 Antibody

TSGA2 Antibody

TSGA2 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (5)

Reviews

TSGA2 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map