RPS25 Antibody - BSA Free NBP1-80802 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RPS25 Antibody

Western Blot: RPS25 Antibody [NBP1-80802]
RPS25 Antibody

RPS25 Antibody
RPS25 Antibody

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
RPS25 Antibody

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
RPS25 Antibody

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RPS25 Antibody - BSA Free

Product Specs
ItemRPS25 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-80802
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: VPNYKLITPA VVSERLKIRG SLARAALQEL LSKGLIKLVS KHRAQVIYTR NTKGGDAPAA GEDA
NCBI Gene AliaseseS25, S25
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
TargetRPS25
ReactivityHuman,Mouse,Rat
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
NCBI Full Gene Nameribosomal protein S25
IsotypeIgG
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
ClonalityPolyclonal

Sequence

VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Specific tRNAs promote mRNA decay by recruiting the CCR4-NOT complex to translating ribosomesScience (New York, N.Y.)November 22, 2024Zhu X, Cruz VE, Zhang H, Erzberger JP, Mendell JT.

(2) SWI/SNF chromatin remodeling subunit Smarca4/BRG1 is essential for female fertility†Biology of reproductionFebruary 13, 2023Abedini A, Landry DA, Macaulay AD, Vaishnav H, Parbhakar A, Ibrahim D, Salehi R, Maranda V, Macdonald E, Vanderhyden BC.

(3) Hepatocytic AP-1 and STAT3 contribute to chemotaxis in alphanaphthylisothiocyanate-induced cholestatic liver injuryToxicology lettersJanuary 15, 2023Luo Y, Kang J, Luo J, Yan Z, Li S, Lu Z, Song Y, Zhang X, Yang J, Liu A.

Be the First to Write a Review!