Testican 2/SPOCK2 Antibody - BSA Free NBP1-92442 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Testican 2/SPOCK2 Antibody

Western Blot: Testican 2/SPOCK2 Antibody [NBP1-92442]
Testican 2/SPOCK2 Antibody

Testican 2/SPOCK2 Antibody
Testican 2/SPOCK2 Antibody

Western Blot: Testican 2/SPOCK2 Antibody [NBP1-92442] - Analysis in control (vector only transfected HEK293T lysate) and SPOCK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Testican 2/SPOCK2 Antibody

Western Blot: Testican 2/SPOCK2 Antibody [NBP1-92442] - Analysis in control (vector only transfected HEK293T lysate) and SPOCK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Testican 2/SPOCK2 Antibody

Western Blot: Testican 2/SPOCK2 Antibody [NBP1-92442] - Analysis in control (vector only transfected HEK293T lysate) and SPOCK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Testican 2/SPOCK2 Antibody - BSA Free

Product Specs
ItemTestican 2/SPOCK2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-92442
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
TargetTestican 2/SPOCK2
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: EQQACLSSKQ LAVRCEGPCP CPTEQAATST ADGKPETCTG QDLADLGDRL RDWFQLLHEN SKQNGSASSV AGPASGLDKS LGASCKDS
ReactivityHuman
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameSPARC (osteonectin), cwcv and kazal like domains proteoglycan 2
NCBI Gene Aliasestestican-2

Sequence

EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!