NDP52 Antibody - BSA Free NBP1-87873 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

NDP52 Antibody

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Analysis in human testis and pancreas tissues. Corresponding NDP52 RNA-seq data are presented for the same tissues.
NDP52 Antibody

NDP52 Antibody
NDP52 Antibody

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Analysis in human testis and pancreas tissues. Corresponding NDP52 RNA-seq data are presented for the same tissues.
NDP52 Antibody

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Analysis in human testis and pancreas tissues. Corresponding NDP52 RNA-seq data are presented for the same tissues.
NDP52 Antibody

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Analysis in human testis and pancreas tissues. Corresponding NDP52 RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
NDP52 Antibody - BSA Free

Product Specs
ItemNDP52 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-87873
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ReactivityHuman
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
PurityAffinity purified
TargetNDP52
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: YYLPKDDEYY QFCYVDEDGV VRGASIPFQF RPENEEDILV VTTQGEVEEI EQHNKELCKE NQELKDSCIS LQKQNSD
HostRabbit
IsotypeIgG
Antibody TypePrimary Antibodies
ClonalityPolyclonal
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namecalcium binding and coiled-coil domain 2
NCBI Gene AliasesNDP52

Specifications/Features

Available conjugates: Unconjugated

Sequence

YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!