Ribosomal protein L26 Antibody - BSA Free NBP1-80812 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Ribosomal protein L26 Antibody

Western Blot: Ribosomal protein L26 Antibody [NBP1-80812] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
Ribosomal protein L26 Antibody

Ribosomal protein L26 Antibody
Ribosomal protein L26 Antibody

Western Blot: Ribosomal protein L26 Antibody [NBP1-80812] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
Ribosomal protein L26 Antibody

Western Blot: Ribosomal protein L26 Antibody [NBP1-80812] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Ribosomal protein L26 Antibody - BSA Free

Product Specs
ItemRibosomal protein L26 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-80812
Quantity0.1 ml
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
PurityAffinity purified
TargetRibosomal protein L26
HostRabbit
IsotypeIgG
Antibody TypePrimary Antibodies
NCBI Gene AliasesuL24, DBA11, L26
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: NPFVTSDRSK NRKRHFNAPS HVRRKIMSSP LSKELRQKYN VRSMPIRKDD EVQVVRGHYK GQQIGKVVQV YRKKYVIYIE RVQREKANGT TVHV
NCBI Full Gene Nameribosomal protein L26
ClonalityPolyclonal
Research AreaCellular Markers
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Specifications/Features

Available conjugates: Unconjugated

Sequence

NPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHV

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!