OCIAD2 Antibody - BSA Free NBP1-82683 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

OCIAD2 Antibody

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.
OCIAD2 Antibody

OCIAD2 Antibody
OCIAD2 Antibody

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.
OCIAD2 Antibody

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.
OCIAD2 Antibody

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
OCIAD2 Antibody - BSA Free

Product Specs
ItemOCIAD2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-82683
ReactivityHuman
Quantity0.1 ml (also 25ul)
HostRabbit
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: GVCQSKFHFF EDQLRGAGFG PQHNRHCLLT CEECKIKHGL SEKGDSQPSA S
TargetOCIAD2
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
Research AreaCancer
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameOCIA domain containing 2

Sequence

GVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!