DNASE1 Antibody - BSA Free NBP1-84999 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

DNASE1 Antibody

Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
DNASE1 Antibody

DNASE1 Antibody
DNASE1 Antibody

Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
DNASE1 Antibody

Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
DNASE1 Antibody

Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
DNASE1 Antibody - BSA Free

Product Specs
ItemDNASE1 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-84999
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ReactivityHuman
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
PurityAffinity purified
TargetDNASE1
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: YVRPSQWSSI RLWTSPTFQW LIPDSADTTA TPTHCAYDRI VVAGMLLRGA VVPDSALPFN FQAAYGLSDQ LAQAISDHY
HostRabbit
IsotypeIgG
Antibody TypePrimary Antibodies
ClonalityPolyclonal
Research AreaApoptosis, DNA Repair, DNA replication Transcription Translation and Splicing
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namedeoxyribonuclease 1
NCBI Gene AliasesDNL1, DRNI

Specifications/Features

Available conjugates: Unconjugated

Sequence

YVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQLAQAISDHY

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!