eIF4GII Antibody - BSA Free NBP1-84867 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

eIF4GII Antibody

Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84867] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.
eIF4GII Antibody

eIF4GII Antibody
eIF4GII Antibody

Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84867] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.
eIF4GII Antibody

Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84867] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.
eIF4GII Antibody

Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84867] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
eIF4GII Antibody - BSA Free

Product Specs
ItemeIF4GII Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-84867
Conjugate/TagUnconjugated
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: EFDSRRTLTS RGSMGREKND KPLPSATARP NTFMRGGSSK DLLDNQSQEE QRREMLETVK QLTGGVDVER NSTEAERNKT RESAKPEISA MSA
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
TargeteIF4GII
HostRabbit
ReactivityHuman
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameeukaryotic translation initiation factor 4 gamma 3
NCBI Gene AliaseseIF-4G 3, eIF4G 3, eIF4GII

Sequence

EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!