MyBioSource.com's Rabbit Anti-Furin Antibody is a Rabbit Polyclonal antibody. The Rabbit Anti-Furin Antibody was generated using FURIN as the antigen and it reacts with Human, Mouse, Rat, Amoeba/Protozoa, Bacteria/Archaea, Bovine, C. elegans/Worm, Canine, Chicken/Bird, Donkey, Drosophila/Arthropod, Feline, Goat, Guinea Pig, Hamster, Horse, Mollusc, Non-Human Primate, Plant, Porcine, Reptile, Rabbit, Sheep, Virus, Xenopus/Amphibian, Yeast/Fungi, Zebrafish/Fish, Other Invertebrate, and Other Mammalian.
Description
Rabbit Anti Multi-Species Furin (PACE) N-Terminal Polyclonal Affinity Purified HRP Labeled is a polyclonal antibody provided as a Liquid buffered in high phosphate PBS, 100mm phosphate, 150mM NaCl, pH7.6. This antibody was produced against a synthetic peptide directed toward the N-terminal region of human Furin located within the following region: RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI