The Rabbit Anti-Furin Antibody from MyBioSource.com is a Rabbit Polyclonal antibody to FURIN. This antibody recognizes Human, Mouse, Rat, Amoeba/Protozoa, Bacteria/Archaea, Bovine, C. elegans/Worm, Canine, Chicken/Bird, Donkey, Drosophila/Arthropod, Feline, Goat, Guinea Pig, Hamster, Horse, Mollusc, Non-Human Primate, Plant, Porcine, Reptile, Rabbit, Sheep, Virus, Xenopus/Amphibian, Yeast/Fungi, Zebrafish/Fish, Other Invertebrate, and Other Mammalian antigen.
Description
Rabbit Anti Multi-Species Furin (PACE) N-Terminal Polyclonal Affinity Purified FITC Labeled is a polyclonal antibody provided as a Liquid buffered in 1x PBS. This antibody was produced against a synthetic peptide directed toward the N-terminal region of human Furin located within the following region: RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI