Rabbit Anti-APH1A, CT Antibody 303123 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-APH1A, CT Antibody

Anti-APH1a antibody, Western blotting All lanes: Anti APH1a at 0.5ug/ml Lane 1: Mouse Lung Tissue Lysate at 50ug Lane 2: Mouse Liver Tissue Lysate at 50ug Lane 3: SW620 Whole Cell Lysate at 40ug Lane 4: SMMC Whole Cell Lysate at 40ug Lane 5: Human Placenta Tissue Lysate at 50ug Predicted band size: 29KD Observed band size: 29KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-APH1A, CT Antibody

United States Biological's Rabbit Anti-APH1A, CT Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-APH1A, CT Antibody was generated using aph1a as the antigen and it reacts with Homo Sapiens, Human, and Mouse.

Product Specs
ItemRabbit Anti-APH1A, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303123
ClonalityPolyclonal
NCBI Gene Aliases6530402N02Rik, APH-1, APH-1A, CGI-78
NCBI Full Gene Nameaph-1 homolog A, gamma-secretase subunit
ApplicationsWestern Blot (WB)
ReactivityHu, Ms
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
TargetAPH1A, CT
ImmunogenSynthetic peptide corresponding to aa236-265, LRSIQRSLLCRRQEDSRVMVYSALRIPPED, from human APH1A at C-terminus, different from the related mouse sequence by 1aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!