Rabbit Anti-RPL32 Antibody 138305 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-RPL32 Antibody

RPL32 antibody used at 2.5ug/ml to detect target protein (138305) using HepG2 cell lysate as positive control.

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-RPL32 Antibody

United States Biological's Rabbit Anti-RPL32 Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-RPL32 Antibody was generated using RPL32 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemRabbit Anti-RPL32 Antibody
CompanyUnited States Biological
Price $640.00Supplier Page View Company Product Page
Catalog Number138305
Quantity100ug
ApplicationsWB
Concentration~1mg/ml
Conjugate/TagUnconjugated
FormatSupplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide
PurityPurified by Protein A affinity chromatography
ReactivityHu
TargetRPL32
Hostrabbit
Antibody TypePrimary
ImmunogenSynthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG corresponding to the N-terminal region of human RPL32. Species sequence homology: bovine, canine, guinea pig, equine, mouse, rabbit, rat, sheep and zebrafish
ClonalityPolyclonal
NCBI Full Gene Nameribosomal protein L32
NCBI Gene AliaseseL32, PP9932, L32

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!