Pab Rb x mouse TRIF (Toll-like Receptor Adaptor Molecule 1, PRVTIRB, RNF36, TCAM1, TICAM1, TICAM-1, TRIF) antibody 353316 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x mouse TRIF (Toll-like Receptor Adaptor Molecule 1, PRVTIRB, RNF36, TCAM1, TICAM1, TICAM-1, TRIF) antibody

Western blotting All lanes: TRIF at 0.5ug/ml Lane 1: Mouse Brain Tissue Lysate at 50ug Lane 2: Mouse Spleen Tissue Lysate at 50ug Lane 3: Mouse Testis Tissue Lysate at 50ug Lane 4: Mouse Liver Tissue Lysate at 50ug Predicted bind size: 76KD Observed bind size: 130KD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x mouse TRIF (Toll-like Receptor Adaptor Molecule 1, PRVTIRB, RNF36, TCAM1, TICAM1, TICAM-1, TRIF) antibody

The Pab Rb x mouse TRIF (Toll-like Receptor Adaptor Molecule 1, PRVTIRB, RNF36, TCAM1, TICAM1, TICAM-1, TRIF) antibody from United States Biological is a Rabbit Polyclonal antibody to TICAM1. This antibody recognizes Mouse antigen. The Pab Rb x mouse TRIF (Toll-like Receptor Adaptor Molecule 1, PRVTIRB, RNF36, TCAM1, TICAM1, TICAM-1, TRIF) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x mouse TRIF (Toll-like Receptor Adaptor Molecule 1, PRVTIRB, RNF36, TCAM1, TICAM1, TICAM-1, TRIF) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number353316
Antibody TypePrimary
ReactivityMo
FormatSupplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa53-84, QDTEARVSLESLKMNTVAQLVAHQWADMETTE, of mouse TRIF at N-terminal, different from the related human sequence by 12aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameTIR domain containing adaptor molecule 1
NCBI Gene AliasesTICAM-1, TRIF
ClonalityPolyclonal
TargetTRIF

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!