Pab Rb x human MCM8, CT (DNA helicase MCM8, C20orf154, Minichromosome maintenance 8 homologous recombination repair factor) antibody 350733 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human MCM8, CT (DNA helicase MCM8, C20orf154, Minichromosome maintenance 8 homologous recombination repair factor) antibody

All lanes: MCM8 at 0.5ug/ml Lane 1: A549 Whole Cell Lysate at 40ug Lane 2: SW620 Whole Cell Lysate at 40ug Lane 3: HELA Whole Cell Lysate at 40ug Lane 4: PANC Whole Cell Lysate at 40ug Lane 5: HEPG2 Whole Cell Lysate at 40ug Predicted bind size: 94kD Observed bind size: 94kD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human MCM8, CT (DNA helicase MCM8, C20orf154, Minichromosome maintenance 8 homologous recombination repair factor) antibody

United States Biological's Pab Rb x human MCM8, CT (DNA helicase MCM8, C20orf154, Minichromosome maintenance 8 homologous recombination repair factor) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human MCM8, CT (DNA helicase MCM8, C20orf154, Minichromosome maintenance 8 homologous recombination repair factor) antibody was generated using MCM8 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemPab Rb x human MCM8, CT (DNA helicase MCM8, C20orf154, Minichromosome maintenance 8 homologous recombination repair factor) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number350733
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa809-840, IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM, of human MCM8 at C-terminal
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameminichromosome maintenance 8 homologous recombination repair factor
NCBI Gene AliasesC20orf154, POF10, dJ967N21.5
ClonalityPolyclonal
TargetMCM8, CT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!