Pab Rb x human ATG13, CT (KIAA0652, Autophagy-related protein 13) antibody 350553 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human ATG13, CT (KIAA0652, Autophagy-related protein 13) antibody

KIAA0652, Western blotting All lanes: KIAA0652 at 0.5ug/ml Lane 1: HELA Whole Cell Lysate at 40ug Lane 2: HEPA Whole Cell Lysate at 40ug Predicted bind size: 56kD Observed bind size: 56kD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human ATG13, CT (KIAA0652, Autophagy-related protein 13) antibody

United States Biological's Pab Rb x human ATG13, CT (KIAA0652, Autophagy-related protein 13) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human ATG13, CT (KIAA0652, Autophagy-related protein 13) antibody was generated using ATG13 as the antigen and it reacts with Homo Sapiens, Human, and Mouse.

Product Specs
ItemPab Rb x human ATG13, CT (KIAA0652, Autophagy-related protein 13) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number350553
Antibody TypePrimary
ReactivityHu, Mo
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa488-517, MAEDLDSLPEKLAVHEKNVREFDAFVETLQ, of human ATG13 at C-terminal
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameautophagy related 13
NCBI Gene AliasesKIAA0652, PARATARG8
ClonalityPolyclonal
TargetATG13, CT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!