Pab Rb x human SCTR, CT (Secretin Receptor) antibody 371038 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human SCTR, CT (Secretin Receptor) antibody

Western blot analysis of SCTR expression in rat kidney extract (lane 1) and SKOV3 whole cell lysates (lane 2). SCTR at 59KD was detected using SCTR at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human SCTR, CT (Secretin Receptor) antibody

The Pab Rb x human SCTR, CT (Secretin Receptor) antibody from United States Biological is a Rabbit Polyclonal antibody to Secretin Receptor. This antibody recognizes Homo Sapiens, Human, and Rat antigen. The Pab Rb x human SCTR, CT (Secretin Receptor) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human SCTR, CT (Secretin Receptor) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371038
ClonalityPolyclonal
TargetSCTR, CT
NCBI Gene AliasesSR
NCBI Full Gene Namesecretin receptor
ApplicationsWestern Blot (WB)
ReactivityHu, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the C-terminal of human SCTR (aa398-440, EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII)
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!