Pab Rb x human MC3 Receptor (Melanocortin Receptor 3) antibody 377497 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human MC3 Receptor (Melanocortin Receptor 3) antibody

Western blot analysis of MC3 Receptor expression in mouse kidney extract (lane 1), and COLO320 whole cell lysates (lane 2). MC3 Receptor at 40kD was detected using MC3 Receptor at 0.5ug/ml. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human MC3 Receptor (Melanocortin Receptor 3) antibody

The Pab Rb x human MC3 Receptor (Melanocortin Receptor 3) antibody from United States Biological is a Rabbit Polyclonal antibody to MC3R. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The Pab Rb x human MC3 Receptor (Melanocortin Receptor 3) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human MC3 Receptor (Melanocortin Receptor 3) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number377497
Antibody TypePrimary
ReactivityHu, Mo
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa91-121, NALETIMIAIVHSDYLTFEDQFIQHMDNIFD from human MC3 receptor at N-terminal, different from the related mouse sequence by 6aa and from the related rat sequence by 7aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namemelanocortin 3 receptor
NCBI Gene AliasesOQTL, OB20, MC3-R, MC3, BMIQ9
ClonalityPolyclonal
TargetMC3 Receptor

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!