Pab Rb x mouse Gla, CT (Galactosidase, alpha) antibody 370974 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x mouse Gla, CT (Galactosidase, alpha) antibody

Western blot analysis of Gla expression in mouse thymus extract (lane 1), mouse liver extract (lane 2) and mouse spleen extract (lane 3). Gla at 46KD was detected using Gla at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x mouse Gla, CT (Galactosidase, alpha) antibody

The Pab Rb x mouse Gla, CT (Galactosidase, alpha) antibody from United States Biological is a Rabbit Polyclonal antibody to GLA. This antibody recognizes Mouse antigen. The Pab Rb x mouse Gla, CT (Galactosidase, alpha) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x mouse Gla, CT (Galactosidase, alpha) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370974
ClonalityPolyclonal
TargetGla, CT
NCBI Gene AliasesAgs
NCBI Full Gene Namegalactosidase, alpha
ApplicationsWestern Blot (WB)
ReactivityMouse (Ms)
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to aa218-275, DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA at the C-terminal of mouse Gla, different from the related human sequence by 15aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!