Rabbit Anti-TSG101, CT Antibody 303688 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-TSG101, CT Antibody

All lanes: Anti TSG101 at 0.5ug/ml Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug Lane 2: Rat Brain Tissue Lysate at 50ug Lane 3: HELA Whole Cell Lysate at 40ug Lane 4: SMMC Whole Cell Lysate at 40ug Predicted band size: 44KD Observed band size: 44KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-TSG101, CT Antibody

The Rabbit Anti-TSG101, CT Antibody from United States Biological is a Rabbit Polyclonal antibody to TSG101. This antibody recognizes Homo Sapiens, Human, and Rat antigen. The Rabbit Anti-TSG101, CT Antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemRabbit Anti-TSG101, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303688
ClonalityPolyclonal
NCBI Gene AliasesTSG10, VPS23
NCBI Full Gene Nametumor susceptibility 101
ApplicationsWestern Blot (WB)
ReactivityHu, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
TargetTSG101, CT
ImmunogenSynthetic peptide corresponding to aa361-390, KHVRLLSRKQFQLRALMQKARKTAGLSDLY, from human TSG101 at C-terminus, identical to the related mouse and rat sequences
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!