Pab Rb x human INSR, NT (Insulin Receptor) antibody 370991 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human INSR, NT (Insulin Receptor) antibody

Western blot analysis of Insulin Receptor expression in rat kidney extract (lane 1) and HEPG2 whole cell lysates (lane 2). Insulin Receptor at 155KD was detected using Insulin Receptor at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human INSR, NT (Insulin Receptor) antibody

United States Biological's Pab Rb x human INSR, NT (Insulin Receptor) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human INSR, NT (Insulin Receptor) antibody was generated using INSR, and Insulin Receptor as the antigen and it reacts with Homo Sapiens, Human, and Rat.

Product Specs
ItemPab Rb x human INSR, NT (Insulin Receptor) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370991
TargetINSR, NT
ClonalityPolyclonal
NCBI Gene AliasesCD220, HHF5
NCBI Full Gene Nameinsulin receptor
ApplicationsWestern Blot (WB)
ReactivityHu, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human Insulin Receptor (aa38-76, MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences. Species Sequence Homology: bovine, canine, equine, monkey, rabbit
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!