Pab Rb x human TUB 1 (Tubby Protein Homolog) antibody 377647 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human TUB 1 (Tubby Protein Homolog) antibody

Western blot analysis of TUB 1 expression in COLO320 whole cell lysates (lane 1) and MCF-7 whole cell lysates (lane 2). TUB 1 at 62kD was detected using TUB 1 at 0.5ug/ml. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human TUB 1 (Tubby Protein Homolog) antibody

United States Biological's Pab Rb x human TUB 1 (Tubby Protein Homolog) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human TUB 1 (Tubby Protein Homolog) antibody was generated using tub, and TUB bipartite transcription factor as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemPab Rb x human TUB 1 (Tubby Protein Homolog) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number377647
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa395-429, VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT from human TUB1 at C-terminal, different from the related mouse and rat sequences by 1aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameTUB bipartite transcription factor
NCBI Gene Aliasesrd5, RDOB
ClonalityPolyclonal
TargetTUB 1

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!