Rabbit Anti-MMP3, CT Antibody 303460 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-MMP3, CT Antibody

Anti-MMP3 antibody, Western blotting All lanes: Anti MMP3 at 0.5ug/ml WB: Recombinant Human MMP3 Protein 0.5ng Predicted band size: 36KD Observed band size: 36KD
Rabbit Anti-MMP3, CT Antibody

Anti-MMP3 antibody, Western blotting All lanes: Anti MMP3 at 0.5ug/ml Lane 1: Human Placenta Tissue Lysate at 50ug Lane 2: U20S Whole Cell Lysate at 40ug Lane 3: HELA Whole Cell Lysate at 40ug Lane 4: PANC Whole Cell Lysate at 40ug Lane 5: COLO320 Whole Cell Lysate at 40ug Predicted band size: 54KD Observed band size: 54KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-MMP3, CT Antibody

United States Biological's Rabbit Anti-MMP3, CT Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-MMP3, CT Antibody was generated using MMP3 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemRabbit Anti-MMP3, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303460
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa410-439, RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA, from human MMP3 at C-terminal, different from the related mouse sequence by 7aa, and from the related mouse sequence by 10aa
TargetMMP3, CT
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namematrix metallopeptidase 3
NCBI Gene AliasesCHDS6, MMP-3, SL-1, STMY, STMY1, STR1
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!