Rabbit Anti-Interleukin 21 Receptor Antibody I8442-23 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-Interleukin 21 Receptor Antibody

Immunohistochemistry on mouse thymus using I8442-23.

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-Interleukin 21 Receptor Antibody

The Rabbit Anti-Interleukin 21 Receptor Antibody from United States Biological is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The Rabbit Anti-Interleukin 21 Receptor Antibody has been shown to work in the following applications: EIA, Immunoassay, ELISA, Flow Cytometry, and Immunohistochemistry.

Product Specs
ItemRabbit Anti-Interleukin 21 Receptor Antibody
CompanyUnited States Biological
Price $418.00Supplier Page View Company Product Page
Catalog NumberI8442-23
Antibody TypePrimary
ReactivityMo
FormatSupplied as a liquid in PBS, pH 7.2, 0.1% BSA, 0.09% sodium azide
ApplicationsE, FC, IHC
ImmunogenSynthetic peptide corresponding to 35-65 residues, CVLETRSPNPSILSLTWQDEYEELQDQETF, at the N-terminus of mouse IL-21 receptor
TargetInterleukin 21 Receptor
Hostrabbit
Concentration~1mg/ml
Quantity50ug
PurityPurified by affinity chromatography
Conjugate/TagUnconjugated
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!