Pab Rb x human GAB1, NT (GRB2-associated-Binding Protein 1) antibody 370973 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human GAB1, NT (GRB2-associated-Binding Protein 1) antibody

Western blot analysis of GAB1 expression in rat testis extract (lane 1) and K562 whole cell lysates (lane 2). GAB1 at 77KD was detected using GAB1 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human GAB1, NT (GRB2-associated-Binding Protein 1) antibody

The Pab Rb x human GAB1, NT (GRB2-associated-Binding Protein 1) antibody from United States Biological is a Rabbit Polyclonal antibody to GAB1. This antibody recognizes Homo Sapiens, Human, and Rat antigen. The Pab Rb x human GAB1, NT (GRB2-associated-Binding Protein 1) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human GAB1, NT (GRB2-associated-Binding Protein 1) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370973
ClonalityPolyclonal
TargetGAB1, NT
NCBI Gene AliasesDFNB26
NCBI Full Gene NameGRB2 associated binding protein 1
ApplicationsWestern Blot (WB)
ReactivityHu, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human GAB1 (aa72-109, LTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVR), different from the related mouse sequence by 1aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!