Pab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody 370950 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody

Western blot analysis of CYP3A4 expression in HELA whole cell lysates (lane 1). CYP3A4 at 57KD was detected using CYP3A4 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Pab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody

CYP3A4 was detected in paraffin-embedded sections of human liver cancer tissues using CYP3A4 at 1ug/mL. The immunohistochemical section was developed using SABC method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody

United States Biological's Pab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The Pab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody was generated using CYP3A4 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemPab Rb x human CYP3A4 (Cytochrome P450 3A4) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370950
Antibody TypePrimary
ClonalityPolyclonal
TargetCYP3A4
NCBI Gene AliasesP450C3, VDDR3, CYPIIIA4, NF-25, CYP3A3, CYPIIIA3, P450PCN1, CP34, HLP, CYP3A, CP33
NCBI Full Gene Namecytochrome P450 family 3 subfamily A member 4
ApplicationsWB, IHC
ReactivityHuman (Hu)
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (aa237-277, NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID)
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!