Pab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody 371028 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody

Western blot analysis of PSMA1 expression in rat testis extract (lane 1), mouse spleen extract (lane 2) and HEPG2 whole cell lysates (lane 3). PSMA1 at 29KD was detected using PSMA1 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Pab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody

PSMA1 was detected in paraffin-embedded sections of human intetsinal cancer tissues using PSMA1 at 1ug/mL. The immunohistochemical section was developed using SABC method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody

United States Biological's Pab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The Pab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody was generated using PSMA1 as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemPab Rb x human PSMA1, CT (Proteasome Subunit alpha Type-1) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371028
ClonalityPolyclonal
TargetPSMA1, CT
NCBI Gene AliasesHC2, PROS30, NU, HEL-S-275
NCBI Full Gene Nameproteasome 20S subunit alpha 1
ApplicationsWB, IHC
ReactivityHu, Ms, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the C-terminal of human PSMA1 (aa159-204, MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by 1aa, and from the related rat sequence by 2aa. Species Sequence Homology: bovine, canine, hamster, equine, monkey, rabbit
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!