Pab Rb x human CNP (2',3'-cyclic-nucleotide 3'-phosphodiesterase, CNPase) antibody 370942 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human CNP (2',3'-cyclic-nucleotide 3'-phosphodiesterase, CNPase) antibody

Western blot analysis of CNPase expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). CNPase at 47KD was detected using CNPase at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human CNP (2',3'-cyclic-nucleotide 3'-phosphodiesterase, CNPase) antibody

United States Biological's Pab Rb x human CNP (2',3'-cyclic-nucleotide 3'-phosphodiesterase, CNPase) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human CNP (2',3'-cyclic-nucleotide 3'-phosphodiesterase, CNPase) antibody was generated using CNP as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemPab Rb x human CNP (2',3'-cyclic-nucleotide 3'-phosphodiesterase, CNPase) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370942
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence in the middle region of human CNPase (aa142-178, QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by 1aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Name2',3'-cyclic nucleotide 3' phosphodiesterase
NCBI Gene AliasesCNP1, HLD20
ClonalityPolyclonal
TargetCNP

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!