Pab Rb x human FGB (Fibrinogen Beta Chain) antibody 370964 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human FGB (Fibrinogen Beta Chain) antibody

Western blot analysis of FGB expression in rat kidney extract (lane 1), mouse liver extract (lane 2) and HELA whole cell lysates (lane 3). FGB at 56KD was detected using FGB at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human FGB (Fibrinogen Beta Chain) antibody

United States Biological's Pab Rb x human FGB (Fibrinogen Beta Chain) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human FGB (Fibrinogen Beta Chain) antibody was generated using FGB, and Fibrinogen beta chain as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemPab Rb x human FGB (Fibrinogen Beta Chain) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370964
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
ReactivityHu, Ms, Rt
ApplicationsWestern Blot (WB)
NCBI Full Gene Namefibrinogen beta chain
NCBI Gene AliasesHEL-S-78p
ClonalityPolyclonal
TargetFGB
ImmunogenSynthetic peptide corresponding to a sequence in the middle region of human FGB (aa193-225, TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by 3aa, and from the related rat sequence by 5aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!