Rabbit Anti-Neuropeptide Y Antibody 303478 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-Neuropeptide Y Antibody

Anti- Neuropeptide Y antibody, Western blotting All lanes: Anti Neuropeptide Y at 0.5ug/ml WB: COLO320 Whole Cell Lysate at 40ug Predicted band size: 11KD Observed band size: 30KD
Rabbit Anti-Neuropeptide Y Antibody

IHC(P): Mouse Brain Tissue
Rabbit Anti-Neuropeptide Y Antibody

IHC(P): Rat Brain Tissue

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-Neuropeptide Y Antibody

The Rabbit Anti-Neuropeptide Y Antibody from United States Biological is a Rabbit Polyclonal antibody to neuropeptide Y, and NPY. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Rabbit Anti-Neuropeptide Y Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemRabbit Anti-Neuropeptide Y Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303478
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to aa29-64, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY, from the middle region of human Neuropeptide Y, identical to the related mouse and rat sequences
TargetNeuropeptide Y
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameneuropeptide Y
NCBI Gene AliasesPYY4
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!